CPNE1 antibody (N-Term)

Catalog No. ABIN629980

This Rabbit Polyclonal antibody specifically detects CPNE1 in WB and IHC. It exhibits reactivity toward Human.

Quick Overview for CPNE1 antibody (N-Term) (ABIN629980)

Target: CPNE1 (Copine I (CPNE1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CPNE1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-CPNE1 Antibody

Binding Specificity: N-Term

Specificity: Copine I antibody was raised against the N terminal of CPNE1

Purification: Purified

Immunogen: Copine I antibody was raised using the N terminal of CPNE1 corresponding to a region with amino acids TVQKLRFGIYDIDNKTPELRDDDFLGGAECSLGQIVSSQVLTLPLMLKPG

Application Details

Application Notes: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Copine I Blocking Peptide, (ABIN5612964), is also available for use as a blocking control in assays to test for specificity of this Copine I antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPNE1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CPNE1

Target: CPNE1 (Copine I (CPNE1))

Alternative Name: Copine I

Background: Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. CPNE1 is a calcium-dependent protein that also contains two N-terminal type II C2 domains and an integrin A domain-like sequence in the C-terminus. However, the protein does not contain a predicted signal sequence or transmembrane domains. This protein has a broad tissue distribution and it may function in membrane trafficking.

Molecular Weight: 59 kDa (MW of target protein)