KLHDC8A antibody (C-Term)

Catalog No. ABIN629982

This anti-KLHDC8A antibody is a Rabbit Polyclonal antibody detecting KLHDC8A in WB. Suitable for Human.

Quick Overview for KLHDC8A antibody (C-Term) (ABIN629982)

Target: KLHDC8A (Kelch Domain Containing 8A (KLHDC8A))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KLHDC8A antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-KLHDC8A Antibody

Binding Specificity: C-Term

Specificity: KLHDC8 A antibody was raised against the C terminal of KLHDC8

Purification: Purified

Immunogen: KLHDC8 A antibody was raised using the C terminal of KLHDC8 corresponding to a region with amino acids PGKNKWEILPAMPTPRCACSSIVVKNCLLAVGGVNQGLSDAVEALCVSDS

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KLHDC8A Blocking Peptide, (ABIN5614374), is also available for use as a blocking control in assays to test for specificity of this KLHDC8A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLHDC0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KLHDC8A

Target: KLHDC8A (Kelch Domain Containing 8A (KLHDC8A))

Alternative Name: KLHDC8A

Background: The function of KLHDC8A protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 39 kDa (MW of target protein)