PUF60 antibody (C-Term)

Catalog No. ABIN629984

The Rabbit Polyclonal anti-PUF60 antibody has been validated for WB and IHC. It is suitable to detect PUF60 in samples from Human, Mouse and Rat.

Quick Overview for PUF60 antibody (C-Term) (ABIN629984)

Target: PUF60 (Poly-U Binding Splicing Factor 60KDa (PUF60))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PUF60 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-PUF60 Antibody

Binding Specificity: C-Term

Specificity: PUF60 antibody was raised against the C terminal of PUF60

Purification: Purified

Immunogen: PUF60 antibody was raised using the C terminal of PUF60 corresponding to a region with amino acids PPIPVTIPSVGVVNPILASPPTLGLLEPKKEKEEEELFPESERPEMLSEQ

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PUF60 Blocking Peptide, (ABIN5615676), is also available for use as a blocking control in assays to test for specificity of this PUF60 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PUF60 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PUF60

Target: PUF60 (Poly-U Binding Splicing Factor 60KDa (PUF60))

Alternative Name: PUF60

Background: PUF60 is a Ro RNP-binding protein. It interacts with Ro RNPs and their interaction is thought to represent a gain of function for Ro RNPs. This protein also forms a ternary complex with far upstream element (FUSE) and FUSE-binding protein. It can repress a c-myc reporter via the FUSE. It is also known to target transcription factor IIH and inhibit activated transcription.

Molecular Weight: 58 kDa (MW of target protein)