OLA1 antibody

Catalog No. ABIN629990

The Rabbit Polyclonal anti-OLA1 antibody has been validated for WB and IHC. It is suitable to detect OLA1 in samples from Human, Mouse, Rat and Dog.

Quick Overview for OLA1 antibody (ABIN629990)

Target: OLA1 (Obg-Like ATPase 1 (OLA1))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This OLA1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-OLA1 Antibody

Purification: Purified

Immunogen: GTPBP9 antibody was raised using a synthetic peptide corresponding to a region with amino acids MIGPIIDKLEKVAVRGGDKKLKPEYDIMCKVKSWVIDQKKPVRFYHDWND

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GTPBP9 Blocking Peptide, (ABIN5613905), is also available for use as a blocking control in assays to test for specificity of this GTPBP9 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GTPBP9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for OLA1

Target: OLA1 (Obg-Like ATPase 1 (OLA1))

Alternative Name: GTPBP9

Background: GTPBP9 belongs to the GTP1/OBG family and the function remains unknown.

Molecular Weight: 44 kDa (MW of target protein)