EIF2S1 antibody (C-Term)

Catalog No. ABIN629992

This Rabbit Polyclonal antibody specifically detects EIF2S1 in WB and IHC. It exhibits reactivity toward Human, Mouse, Rat, Dog and Zebrafish (Danio rerio).

Quick Overview for EIF2S1 antibody (C-Term) (ABIN629992)

Target: EIF2S1 (Eukaryotic Translation Initiation Factor 2 Subunit 1 (EIF2S1))

Reactivity: Human, Mouse, Rat, Dog, Zebrafish (Danio rerio)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EIF2S1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-EIF2S1 Antibody

Binding Specificity: C-Term

Specificity: EIF2 S1 antibody was raised against the C terminal of EIF2 1

Purification: Purified

Immunogen: EIF2 S1 antibody was raised using the C terminal of EIF2 1 corresponding to a region with amino acids RGVFNVQMEPKVVTDTDETELARQMERLERENAEVDGDDDAEEMEAKAED

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EIF2S1 Blocking Peptide, (ABIN5613326), is also available for use as a blocking control in assays to test for specificity of this EIF2S1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EIF2S1

Target: EIF2S1 (Eukaryotic Translation Initiation Factor 2 Subunit 1 (EIF2S1))

Alternative Name: EIF2S1

Background: The translation initiation factor eIF2 catalyzes the first regulated step of protein synthesis initiation, promoting the binding of the initiator tRNA to 40S ribosomal subunits. Binding occurs as a ternary complex of methionyl-tRNA, eIF2, and GTP. eIF2 is composed of 3 nonidentical subunits, alpha (36 kDa), beta (38 kDa), and gamma (52 kDa). The rate of formation of the ternary complex is modulated by the phosphorylation state of eIF2-alpha.

Molecular Weight: 35 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization, ER-Nucleus Signaling, Hepatitis C