TRA2B antibody

Catalog No. ABIN629994

This anti-TRA2B antibody is a Rabbit Polyclonal antibody detecting TRA2B in WB and IHC. Suitable for Human, Mouse, Dog and Rat.

Quick Overview for TRA2B antibody (ABIN629994)

Target: TRA2B (Transformer 2 beta Homolog (TRA2B))

Reactivity: Human, Mouse, Dog, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TRA2B antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-TRA2B Antibody

Purification: Purified

Immunogen: SFRS10 antibody was raised using a synthetic peptide corresponding to a region with amino acids GVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVD

Application Details

Application Notes: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SFRS10 Blocking Peptide, (ABIN939022), is also available for use as a blocking control in assays to test for specificity of this SFRS10 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFRS10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TRA2B

Target: TRA2B (Transformer 2 beta Homolog (TRA2B))

Alternative Name: SFRS10

Background: SFRS10 contains 1 RRM (RNA recognition motif) domain and belongs to the splicing factor SR family. It is a sequence-specific RNA-binding protein which participates in the control of pre-mRNA splicing.

Molecular Weight: 32 kDa (MW of target protein)