SNRPF antibody (N-Term)

Catalog No. ABIN629996

The Rabbit Polyclonal anti-SNRPF antibody has been validated for WB and IHC. It is suitable to detect SNRPF in samples from Human, Mouse, Rat, Dog and Zebrafish (Danio rerio).

Quick Overview for SNRPF antibody (N-Term) (ABIN629996)

Target: SNRPF (Small Nuclear Ribonucleoprotein Polypeptide F (SNRPF))

Reactivity: Human, Mouse, Rat, Dog, Zebrafish (Danio rerio)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SNRPF antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-SNRPF Antibody

Binding Specificity: N-Term

Specificity: SNRPF antibody was raised against the N terminal of SNRPF

Purification: Purified

Immunogen: SNRPF antibody was raised using the N terminal of SNRPF corresponding to a region with amino acids MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEY

Application Details

Application Notes: WB: 0.31 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SNRPF Blocking Peptide, (ABIN5616328), is also available for use as a blocking control in assays to test for specificity of this SNRPF antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNRPF antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SNRPF

Target: SNRPF (Small Nuclear Ribonucleoprotein Polypeptide F (SNRPF))

Alternative Name: SNRPF

Background: SNRPF belongs to the snRNP Sm proteins family and is associated with snRNP U1, U2, U4/U6 and U5.

Molecular Weight: 9 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization