RPL8 antibody (C-Term)

Catalog No. ABIN629999

The Rabbit Polyclonal anti-RPL8 antibody has been validated for WB and IHC. It is suitable to detect RPL8 in samples from Human, Mouse, Rat and Dog.

Quick Overview for RPL8 antibody (C-Term) (ABIN629999)

Target: RPL8 (Ribosomal Protein L8 (RPL8))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RPL8 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-RPL8 Antibody

Binding Specificity: C-Term

Specificity: RPL8 antibody was raised against the C terminal of RPL8

Purification: Purified

Immunogen: RPL8 antibody was raised using the C terminal of RPL8 corresponding to a region with amino acids EHPFGGGNHQHIGKPSTIRRDAPAGRKVGLIAARRTGRLRGTKTVQEKEN

Application Details

Application Notes: WB: 0.3125 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RPL8 Blocking Peptide, (ABIN937841), is also available for use as a blocking control in assays to test for specificity of this RPL8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPL8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RPL8

Target: RPL8 (Ribosomal Protein L8 (RPL8))

Alternative Name: RPL8

Background: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPL8 is a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L2P family of ribosomal proteins. It is located in the cytoplasm.

Molecular Weight: 28 kDa (MW of target protein)

Pathways: Regulation of Cell Size