CPSF6 antibody (Middle Region)
-
- Target See all CPSF6 Antibodies
- CPSF6 (Cleavage and Polyadenylation Specific Factor 6, 68kDa (CPSF6))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CPSF6 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- CPSF6 antibody was raised against the middle region of CPSF6
- Purification
- Purified
- Immunogen
- CPSF6 antibody was raised using the middle region of CPSF6 corresponding to a region with amino acids PPLAGPPNRGDRPPPPVLFPGQPFGQPPLGPLPPGPPPPVPGYGPPPGPP
- Top Product
- Discover our top product CPSF6 Primary Antibody
-
-
- Application Notes
-
WB: 0.3125 µg/mL, IHC: 16 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CPSF6 Blocking Peptide, catalog no. 33R-7262, is also available for use as a blocking control in assays to test for specificity of this CPSF6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPSF6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CPSF6 (Cleavage and Polyadenylation Specific Factor 6, 68kDa (CPSF6))
- Alternative Name
- CPSF6 (CPSF6 Products)
- Background
- CPSF6 is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and facilitates the recruitement of other processing factors. The cleavage factor complex is composed of four polypeptides.
- Molecular Weight
- 61 kDa (MW of target protein)
-