PRP6/ANT-1 antibody

Catalog No. ABIN630022

This Rabbit Polyclonal antibody specifically detects PRP6/ANT-1 in WB. It exhibits reactivity toward Human, Mouse, Rat, Dog and Zebrafish (Danio rerio).

Quick Overview for PRP6/ANT-1 antibody (ABIN630022)

Target: PRP6/ANT-1 (PRPF6) (PRP6 Pre-mRNA Processing Factor 6 Homolog (PRPF6))

Reactivity: Human, Mouse, Rat, Dog, Zebrafish (Danio rerio)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PRP6/ANT-1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PRP6/ANT-1 Antibody

Purification: Purified

Immunogen: PRPF6 antibody was raised using a synthetic peptide corresponding to a region with amino acids PGKRTVGDQMKKNQAADDDDEDLNDTNYDEFNGYAGSLFSSGPYEKDDEE

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PRPF6 Blocking Peptide, (ABIN5615582), is also available for use as a blocking control in assays to test for specificity of this PRPF6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRPF6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PRP6/ANT-1

Target: PRP6/ANT-1 (PRPF6) (PRP6 Pre-mRNA Processing Factor 6 Homolog (PRPF6))

Alternative Name: PRPF6

Background: PRPF6 appears to be involved in pre-mRNA splicing, possibly acting as a bridging factor between U5 and U4/U6 snRNPs in formation of the spliceosome. PRPF6 also can bind androgen receptor, providing a link between transcriptional activation and splicing.

Molecular Weight: 104 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization, Proton Transport, Dicarboxylic Acid Transport