RBM4B antibody (C-Term)

Catalog No. ABIN630027

This anti-RBM4B antibody is a Rabbit Polyclonal antibody detecting RBM4B in WB and IHC. Suitable for Human.

Quick Overview for RBM4B antibody (C-Term) (ABIN630027)

Target: RBM4B (RNA Binding Motif Protein 4B (RBM4B))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RBM4B antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-RBM4B Antibody

Binding Specificity: C-Term

Specificity: RBM4 B antibody was raised against the C terminal of RBM4

Purification: Purified

Immunogen: RBM4 B antibody was raised using the C terminal of RBM4 corresponding to a region with amino acids AAAATTSSYYGRDRSPLRRAAAMLPTVGEGYGYGPESELSQASAATRNSL

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RBM4B Blocking Peptide, (ABIN935962), is also available for use as a blocking control in assays to test for specificity of this RBM4B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RBM4B

Target: RBM4B (RNA Binding Motif Protein 4B (RBM4B))

Alternative Name: RBM4B

Background: RBM4B contains 1 CCHC-type zinc finger and 2 RRM (RNA recognition motif) domains. It may play a role in alternative splice site selection during pre-mRNA processing.

Molecular Weight: 39 kDa (MW of target protein)

Pathways: Photoperiodism