NOVA2 antibody (N-Term)

Catalog No. ABIN630042

This anti-NOVA2 antibody is a Rabbit Polyclonal antibody detecting NOVA2 in WB. Suitable for Human and Zebrafish (Danio rerio).

Quick Overview for NOVA2 antibody (N-Term) (ABIN630042)

Target: NOVA2 (Neuro-Oncological Ventral Antigen 2 (NOVA2))

Reactivity: Human, Zebrafish (Danio rerio)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NOVA2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-NOVA2 Antibody

Binding Specificity: N-Term

Specificity: NOVA2 antibody was raised against the N terminal of NOVA2

Purification: Purified

Immunogen: NOVA2 antibody was raised using the N terminal of NOVA2 corresponding to a region with amino acids MEPEAPDSRKRPLETPPEVVCTKRSNTGEEGEYFLKVLIPSYAAGSIIGK

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NOVA2 Blocking Peptide, (ABIN5615033), is also available for use as a blocking control in assays to test for specificity of this NOVA2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NOVA2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NOVA2

Target: NOVA2 (Neuro-Oncological Ventral Antigen 2 (NOVA2))

Alternative Name: NOVA2

Background: NOVA2 may regulate RNA splicing or metabolism in a specific subset of developing neurons. It binds single strand RNA.

Molecular Weight: 54 kDa (MW of target protein)