RG9MTD2 antibody

Catalog No. ABIN630045

This anti-RG9MTD2 antibody is a Rabbit Polyclonal antibody detecting RG9MTD2 in WB. Suitable for Human.

Quick Overview for RG9MTD2 antibody (ABIN630045)

Target: RG9MTD2 (RNA (Guanine-9-) Methyltransferase Domain Containing 2 (RG9MTD2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RG9MTD2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RG9MTD2 Antibody

Purification: Purified

Immunogen: RG9 MTD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EDLIYLTSDSPNILKELDESKAYVIGGLVDHNHHKGLTYKQASDYGINHA

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RG9MTD2 Blocking Peptide, (ABIN937703), is also available for use as a blocking control in assays to test for specificity of this RG9MTD2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RG0 TD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RG9MTD2

Target: RG9MTD2 (RNA (Guanine-9-) Methyltransferase Domain Containing 2 (RG9MTD2))

Alternative Name: RG9MTD2

Background: RG9MTD2 is a probable RNA methyltransferase.

Molecular Weight: 37 kDa (MW of target protein)