ACCN5 antibody (Middle Region)
-
- Target See all ACCN5 Antibodies
- ACCN5 (Amiloride-Sensitive Cation Channel 5, Intestinal (ACCN5))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ACCN5 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ACCN5 antibody was raised against the middle region of ACCN5
- Purification
- Purified
- Immunogen
- ACCN5 antibody was raised using the middle region of ACCN5 corresponding to a region with amino acids FTEYGNCFTFNHGETLQAKRKVSVSGRGLSLLFNVNQEAFTDNPALGFVD
- Top Product
- Discover our top product ACCN5 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ACCN5 Blocking Peptide, catalog no. 33R-3090, is also available for use as a blocking control in assays to test for specificity of this ACCN5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACCN5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ACCN5 (Amiloride-Sensitive Cation Channel 5, Intestinal (ACCN5))
- Alternative Name
- ACCN5 (ACCN5 Products)
- Background
- ACCN5 belongs to the amiloride-sensitive Na+ channel and degenerin (NaC/DEG) family, members of which have been identified in many animal species ranging from the nematode to human. The amiloride-sensitive Na(+) channel encoded by this gene is primarily expressed in the small intestine, however, its exact function is not known.
- Molecular Weight
- 56 kDa (MW of target protein)
-