ACCN5 antibody (Middle Region)

Catalog No. ABIN630083

Product Details anti-ACCN5 Antibody

Target: ACCN5 (Amiloride-Sensitive Cation Channel 5, Intestinal (ACCN5))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ACCN5 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ACCN5 antibody was raised against the middle region of ACCN5

Purification: Purified

Immunogen: ACCN5 antibody was raised using the middle region of ACCN5 corresponding to a region with amino acids FTEYGNCFTFNHGETLQAKRKVSVSGRGLSLLFNVNQEAFTDNPALGFVD

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ACCN5 Blocking Peptide, catalog no. 33R-3090, is also available for use as a blocking control in assays to test for specificity of this ACCN5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACCN5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ACCN5

Target: ACCN5 (Amiloride-Sensitive Cation Channel 5, Intestinal (ACCN5))

Alternative Name: ACCN5 (ACCN5 Products)

Synonyms: ACCN5 antibody, HINAC antibody, INAC antibody, Accn5 antibody, Blinac antibody, Inac antibody, acid sensing ion channel subunit family member 5 antibody, acid-sensing (proton-gated) ion channel family member 5 antibody, ASIC5 antibody, asic5 antibody, Asic5 antibody

Background: ACCN5 belongs to the amiloride-sensitive Na+ channel and degenerin (NaC/DEG) family, members of which have been identified in many animal species ranging from the nematode to human. The amiloride-sensitive Na(+) channel encoded by this gene is primarily expressed in the small intestine, however, its exact function is not known.

Molecular Weight: 56 kDa (MW of target protein)