KCNK3 antibody (C-Term)

Catalog No. ABIN630109

Product Details anti-KCNK3 Antibody

Target: KCNK3 (Potassium Channel, Subfamily K, Member 3 (KCNK3))

Binding Specificity: C-Term

Reactivity: Rat, Mouse, Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KCNK3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: KCNK3 antibody was raised against the C terminal of KCNK3

Purification: Purified

Immunogen: KCNK3 antibody was raised using the C terminal of KCNK3 corresponding to a region with amino acids TCVEQSHSSPGGGGRYSDTPSRRCLCSGAPRSAISSVSTGLHSLSTFRGL

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KCNK3 Blocking Peptide, catalog no. 33R-9002, is also available for use as a blocking control in assays to test for specificity of this KCNK3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNK3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KCNK3

Target: KCNK3 (Potassium Channel, Subfamily K, Member 3 (KCNK3))

Alternative Name: KCNK3 (KCNK3 Products)

Synonyms: si:dkey-164m15.1 antibody, K2p3.1 antibody, OAT1 antibody, PPH4 antibody, TASK antibody, TASK-1 antibody, TBAK1 antibody, cTBAK-1 antibody, Task-1 antibody, rTASK antibody, KCNK3 antibody, potassium channel, subfamily K, member 3a antibody, potassium two pore domain channel subfamily K member 3 antibody, potassium channel, subfamily K, member 3 antibody, kcnk3a antibody, KCNK3 antibody, Kcnk3 antibody

Background: KCNK3 encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. The gene product is an outwardly rectifying channel that is sensitive to changes in extracellular pH and is inhibited by extracellular acidification. Also referred to as an acid-sensitive potassium channel, it is activated by the anesthetics halothane and isoflurane. Although three transcripts are detected in northern blots, there is currently no sequence available to confirm transcript variants for this gene.

Molecular Weight: 43 kDa (MW of target protein)