TRPM3 antibody (N-Term)

Catalog No. ABIN630116

The Rabbit Polyclonal anti-TRPM3 antibody is suitable to detect TRPM3 in samples from Human, Mouse, Rat and Dog. It has been validated for WB.

Quick Overview for TRPM3 antibody (N-Term) (ABIN630116)

Target: TRPM3 (Transient Receptor Potential Cation Channel, Subfamily M, Member 3 (TRPM3))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TRPM3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TRPM3 Antibody

Binding Specificity: N-Term

Specificity: TRPM3 antibody was raised against the N terminal of TRPM3

Purification: Purified

Immunogen: TRPM3 antibody was raised using the N terminal of TRPM3 corresponding to a region with amino acids ALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQD

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TRPM3 Blocking Peptide, (ABIN936762), is also available for use as a blocking control in assays to test for specificity of this TRPM3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRPM3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TRPM3

Target: TRPM3 (Transient Receptor Potential Cation Channel, Subfamily M, Member 3 (TRPM3))

Alternative Name: TRPM3

Background: TRPM3 encodes a protein that belongs to the family of transient receptor potential (TRP) channels. TRP channels are cation-selective channels important for cellular calcium signaling and homeostasis. The encoded protein mediates calcium entry, and this entry is potentiated by calcium store depletion.

Molecular Weight: 188 kDa (MW of target protein)