CHRNB2 antibody

Catalog No. ABIN630117

This anti-CHRNB2 antibody is a Rabbit Polyclonal antibody detecting CHRNB2 in WB and IHC. Suitable for Human.

Quick Overview for CHRNB2 antibody (ABIN630117)

Target: CHRNB2 (Cholinergic Receptor, Nicotinic, beta 2 (Neuronal) (CHRNB2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CHRNB2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-CHRNB2 Antibody

Purification: Purified

Immunogen: CHRNB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids CKIEVKHFPFDQQNCTMKFRSWTYDRTEIDLVLKSEVASLDDFTPSGEWD

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CHRNB2 Blocking Peptide, (ABIN937108), is also available for use as a blocking control in assays to test for specificity of this CHRNB2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHRNB2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CHRNB2

Target: CHRNB2 (Cholinergic Receptor, Nicotinic, beta 2 (Neuronal) (CHRNB2))

Alternative Name: CHRNB2

Background: Mutations in nAChRs are found in a rare form of nocturnal frontal lobe epilepsy . Previously, some nAChR mutations have been described that are associated with additional neurological features such as psychiatric disorders or cognitive defects. A new CHRNB2 mutation located in transmembrane region 3 (M3), outside the known ADNFLE mutation cluster. The CHRNB2 mutation I312M, which occurred de novo in twins, markedly increases the receptor's sensitivity to acetylcholine. Phenotypically, the mutation is associated not only with typical ADNFLE, but also with distinct deficits in memory. The cognitive problems are most obvious in tasks requiring the organization and storage of verbal information.

Molecular Weight: 57 kDa (MW of target protein)

Pathways: Sensory Perception of Sound, Feeding Behaviour