TR4 antibody (C-Term)
-
- Target See all TR4 (NR2C2) Antibodies
- TR4 (NR2C2) (Nuclear Receptor Subfamily 2, Group C, Member 2 (NR2C2))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Rat, Mouse, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TR4 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- NR2 C2 antibody was raised against the C terminal of NR2 2
- Purification
- Purified
- Immunogen
- NR2 C2 antibody was raised using the C terminal of NR2 2 corresponding to a region with amino acids AQCAQVMSLSTILAAIVNHLQNSIQEDKLSGDRIKQVMEHIWKLQEFCNS
- Top Product
- Discover our top product NR2C2 Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NR2C2 Blocking Peptide, catalog no. 33R-1445, is also available for use as a blocking control in assays to test for specificity of this NR2C2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NR0 2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TR4 (NR2C2) (Nuclear Receptor Subfamily 2, Group C, Member 2 (NR2C2))
- Alternative Name
- NR2C2 (NR2C2 Products)
- Background
- Members of the nuclear hormone receptor family, such as NR2C2, act as ligand-activated transcription factors. The proteins have an N-terminal transactivation domain, a central DNA-binding domain with 2 zinc fingers, and a ligand-binding domain at the C terminus. The activated receptor/ligand complex is translocated to the nucleus where it binds to hormone response elements of target genes.Members of the nuclear hormone receptor family, such as NR2C2, act as ligand-activated transcription factors. The proteins have an N-terminal transactivation domain, a central DNA-binding domain with 2 zinc fingers, and a ligand-binding domain at the C terminus.
- Molecular Weight
- 67 kDa (MW of target protein)
- Pathways
- TCR Signaling, Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response, Tube Formation, Toll-Like Receptors Cascades
-