RED1 antibody

Catalog No. ABIN630123

This anti-RED1 antibody is a Rabbit Polyclonal antibody detecting RED1 in WB. Suitable for Human, Rat and Mouse.

Quick Overview for RED1 antibody (ABIN630123)

Target: RED1 (ADARB1) (Adenosine Deaminase, RNA-Specific, B1 (ADARB1))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RED1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RED1 Antibody

Purification: Purified

Immunogen: ADARB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QLSNGGGGGPGRKRPLEEGSNGHSKYRLKKRRKTPGPVLPKNALMQLNEI

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ADARB1 Blocking Peptide, (ABIN5611941), is also available for use as a blocking control in assays to test for specificity of this ADARB1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADARB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RED1

Target: RED1 (ADARB1) (Adenosine Deaminase, RNA-Specific, B1 (ADARB1))

Alternative Name: ADARB1

Background: ADARB1 is an enzyme responsible for pre-mRNA editing of the glutamate receptor subunit B by site-specific deamination of adenosines. Studies in rat found that this enzyme acted on its own pre-mRNA molecules to convert an AA dinucleotide to an AI dinucleotide which resulted in a new splice site.

Molecular Weight: 77 kDa (MW of target protein)