-
- Target See all PLAP (ALPP) Antibodies
- PLAP (ALPP) (Placental Alkaline Phosphatase (ALPP))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PLAP antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Purified
- Immunogen
- ALPP antibody was raised using a synthetic peptide corresponding to a region with amino acids TVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAVPLDEETHAGEDVA
- Top Product
- Discover our top product ALPP Primary Antibody
-
anti-Placental Alkaline Phosphatase (ALPP) (N-Term) antibody
ALPP Reactivity: Human, Mouse WB, ELISA Host: Rabbit Polyclonal unconjugated
anti-Placental Alkaline Phosphatase (ALPP) antibodyALPP Reactivity: Human WB, IHC, ELISA Host: Mouse Monoclonal 3E5 unconjugated
anti-Placental Alkaline Phosphatase (ALPP) antibodyALPP Reactivity: Human IHC, ISt Host: Mouse Monoclonal ALP-870 unconjugated
anti-Placental Alkaline Phosphatase (ALPP) antibodyALPP Reactivity: Human IHC, ISt Host: Rabbit Monoclonal ALPP-2899R unconjugated Recombinant Antibody
anti-Placental Alkaline Phosphatase (ALPP) antibodyALPP Reactivity: Human IHC, ISt Host: Mouse Monoclonal GM022 unconjugated
anti-Placental Alkaline Phosphatase (ALPP) antibodyALPP Reactivity: Human IHC Host: Rabbit Monoclonal MSVA-350R unconjugated Recombinant Antibody
anti-Placental Alkaline Phosphatase (ALPP) (N-Term) antibodyALPP Reactivity: Human WB, ELISA Host: Rabbit Polyclonal unconjugated
anti-Placental Alkaline Phosphatase (ALPP) antibodyALPP Reactivity: Human WB, ELISA, IHC (fro), IHC (p) Host: Mouse Monoclonal H7E8 unconjugated
anti-Placental Alkaline Phosphatase (ALPP) (AA 260-520) antibodyALPP Reactivity: Human WB, IHC, ELISA, IP Host: Rabbit Polyclonal unconjugated
anti-Placental Alkaline Phosphatase (ALPP) (AA 282-309) antibodyALPP Reactivity: Human WB, IHC (p) Host: Rabbit Polyclonal RB33849 unconjugated
-
- Application Notes
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ALPP Blocking Peptide, catalog no. 33R-9362, is also available for use as a blocking control in assays to test for specificity of this ALPP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALPP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PLAP (ALPP) (Placental Alkaline Phosphatase (ALPP))
- Alternative Name
- ALPP (ALPP Products)
- Background
- There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). The first three are located together on chromosome 2 while the tissue non-specific form is located on chromosome 1. ALPP is a membrane bound glycosylated enzyme, also referred to as the heat stable form, that is expressed primarily in the placenta although it is closely related to the intestinal form of the enzyme as well as to the placental-like form.
- Molecular Weight
- 59 kDa (MW of target protein)
-
You are here:
