PLAP antibody

Catalog No. ABIN630143

The Rabbit Polyclonal anti-PLAP antibody has been validated for WB and IHC. It is suitable to detect PLAP in samples from Human.

Quick Overview for PLAP antibody (ABIN630143)

Target: PLAP (ALPP) (Placental Alkaline Phosphatase (ALPP))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PLAP antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-PLAP Antibody

Purification: Purified

Immunogen: ALPP antibody was raised using a synthetic peptide corresponding to a region with amino acids TVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAVPLDEETHAGEDVA

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ALPP Blocking Peptide, (ABIN5612037), is also available for use as a blocking control in assays to test for specificity of this ALPP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALPP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PLAP

Target: PLAP (ALPP) (Placental Alkaline Phosphatase (ALPP))

Alternative Name: ALPP

Background: There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). The first three are located together on chromosome 2 while the tissue non-specific form is located on chromosome 1. ALPP is a membrane bound glycosylated enzyme, also referred to as the heat stable form, that is expressed primarily in the placenta although it is closely related to the intestinal form of the enzyme as well as to the placental-like form.

Molecular Weight: 59 kDa (MW of target protein)