A1BG antibody (N-Term)
-
- Target See all A1BG Antibodies
- A1BG (alpha-1-B Glycoprotein (A1BG))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This A1BG antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- A1 BG antibody was raised against the N terminal of A1 G
- Purification
- Purified
- Immunogen
- A1 BG antibody was raised using the N terminal of A1 G corresponding to a region with amino acids ITPGLKTTAVCRGVLRGVTFLLRREGDHEFLEVPEAQEDVEATFPVHQPG
- Top Product
- Discover our top product A1BG Primary Antibody
-
-
- Application Notes
-
WB: 0.2-1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
A1BG Blocking Peptide, catalog no. 33R-4184, is also available for use as a blocking control in assays to test for specificity of this A1BG antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of A0 G antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- A1BG (alpha-1-B Glycoprotein (A1BG))
- Alternative Name
- A1BG (A1BG Products)
- Synonyms
- A1B antibody, ABG antibody, GAB antibody, HYST2477 antibody, A1BG antibody, C44 antibody, alpha-1-B glycoprotein antibody, A1BG antibody, A1bg antibody
- Background
- A1BG is a plasma glycoprotein of unknown function. It shows sequence similarity to the variable regions of some immunoglobulin supergene family member proteins.
- Molecular Weight
- 52 kDa (MW of target protein)
-