Olfactomedin 4 antibody (C-Term)

Catalog No. ABIN630153

This anti-Olfactomedin 4 antibody is a Rabbit Polyclonal antibody detecting Olfactomedin 4 in WB. Suitable for Human.

Quick Overview for Olfactomedin 4 antibody (C-Term) (ABIN630153)

Target: Olfactomedin 4 (OLFM4)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Olfactomedin 4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Olfactomedin 4 Antibody

Binding Specificity: C-Term

Specificity: OLFM4 antibody was raised against the C terminal of OLFM4

Purification: Purified

Immunogen: OLFM4 antibody was raised using the C terminal of OLFM4 corresponding to a region with amino acids EEIFYYYDTNTGKEGKLDIVMHKMQEKVQSINYNPFDQKLYVYNDGYLLN

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

OLFM4 Blocking Peptide, (ABIN937748), is also available for use as a blocking control in assays to test for specificity of this OLFM4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OLFM4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Olfactomedin 4

Target: Olfactomedin 4 (OLFM4)

Alternative Name: OLFM4

Background: OLFM4 is a member of the olfactomedin-related protein family. The exact function of its gene has not yet been determined.

Molecular Weight: 55 kDa (MW of target protein)