Renin antibody (C-Term)

Catalog No. ABIN630157

This Rabbit Polyclonal antibody specifically detects Renin in WB. It exhibits reactivity toward Human, Rat and Mouse.

Quick Overview for Renin antibody (C-Term) (ABIN630157)

Target: Renin (REN)

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Renin antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Renin Antibody

Binding Specificity: C-Term

Specificity: Renin antibody was raised against the C terminal of REN

Purification: Purified

Immunogen: Renin antibody was raised using the C terminal of REN corresponding to a region with amino acids YSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALA

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Renin Blocking Peptide, (ABIN936227), is also available for use as a blocking control in assays to test for specificity of this Renin antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of REN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Renin

Target: Renin (REN)

Alternative Name: Renin

Background: Renin catalyzes the first step in the activation pathway of angiotensinogen--a cascade that can result in aldosterone release,vasoconstriction, and increase in blood pressure. Renin, an aspartyl protease, cleaves angiotensinogen to form angiotensin I, which is converted to angiotensin II by angiotensin I converting enzyme, an important regulator of blood pressure and electrolyte balance. Mutations in this gene have been shown to cause familial hyperproreninemia.

Molecular Weight: 45 kDa (MW of target protein)

Pathways: ACE Inhibitor Pathway, Peptide Hormone Metabolism, Regulation of Systemic Arterial Blood Pressure by Hormones, Feeding Behaviour