Follistatin antibody (C-Term)

Catalog No. ABIN630158

The Rabbit Polyclonal anti-Follistatin antibody has been validated for WB. It is suitable to detect Follistatin in samples from Human, Mouse, Rat and Dog.

Quick Overview for Follistatin antibody (C-Term) (ABIN630158)

Target: Follistatin (FST)

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Follistatin antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Follistatin Antibody

Binding Specificity: C-Term

Specificity: FST antibody was raised against the C terminal of FST

Purification: Purified

Immunogen: FST antibody was raised using the C terminal of FST corresponding to a region with amino acids SLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCN

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FST Blocking Peptide, catalog no. 33R-8580, is also available for use as a blocking control in assays to test for specificity of this FST antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FST antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Follistatin

Target: Follistatin (FST)

Alternative Name: FST

Background: Follistatin is a single-chain gonadal protein that specifically inhibits follicle-stimulating hormone release.Follistatin is a single-chain gonadal protein that specifically inhibits follicle-stimulating hormone release. The single FST gene encodes two isoforms, FST317 and FST344 containing 317 and 344 amino acids respectively, resulting from alternative splicing of the precursor mRNA. In a study in which 37 candidate genes were tested for linkage and association with polycystic ovary syndrome (PCOS) or hyperandrogenemia in 150 families, evidence was found for linkage between PCOS and follistatin.

Molecular Weight: 35 kDa (MW of target protein)

Pathways: Negative Regulation of Hormone Secretion