PSG1 antibody (N-Term)

Catalog No. ABIN630159

This anti-PSG1 antibody is a Rabbit Polyclonal antibody detecting PSG1 in WB and IHC. Suitable for Human.

Quick Overview for PSG1 antibody (N-Term) (ABIN630159)

Target: PSG1 (Pregnancy Specific beta-1-Glycoprotein 1 (PSG1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PSG1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-PSG1 Antibody

Binding Specificity: N-Term

Specificity: PSG1 antibody was raised against the N terminal of PSG1

Purification: Purified

Immunogen: PSG1 antibody was raised using the N terminal of PSG1 corresponding to a region with amino acids SGRETAYSNASLLIQNVTREDAGSYTLHIIKGDDGTRGVTGRFTFTLHLE

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PSG1 Blocking Peptide, (ABIN5615612), is also available for use as a blocking control in assays to test for specificity of this PSG1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSG1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PSG1

Target: PSG1 (Pregnancy Specific beta-1-Glycoprotein 1 (PSG1))

Alternative Name: PSG1

Background: PSG1 plays an immunomodulatory roles during pregnancy.

Molecular Weight: 47 kDa (MW of target protein)