RSAD2 antibody (C-Term)

Catalog No. ABIN630161

The Rabbit Polyclonal anti-RSAD2 antibody has been validated for WB and IHC. It is suitable to detect RSAD2 in samples from Human, Mouse, Dog and Zebrafish (Danio rerio).

Quick Overview for RSAD2 antibody (C-Term) (ABIN630161)

Target: RSAD2 (Radical S-Adenosyl Methionine Domain Containing 2 (RSAD2))

Reactivity: Human, Mouse, Dog, Zebrafish (Danio rerio)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RSAD2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-RSAD2 Antibody

Binding Specificity: C-Term

Specificity: RSAD2 antibody was raised against the C terminal of RSAD2

Purification: Purified

Immunogen: RSAD2 antibody was raised using the C terminal of RSAD2 corresponding to a region with amino acids YLILDEYMRFLNCRKGRKDPSKSILDVGVEEAIKFSGFDEKMFLKRGGKY

Application Details

Application Notes: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RSAD2 Blocking Peptide, (ABIN936140), is also available for use as a blocking control in assays to test for specificity of this RSAD2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RSAD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RSAD2

Target: RSAD2 (Radical S-Adenosyl Methionine Domain Containing 2 (RSAD2))

Alternative Name: RSAD2

Background: RSAD2 is a potential antiviral effector.

Molecular Weight: 40 kDa (MW of target protein)

Pathways: Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response