PNLIP antibody (C-Term)
-
- Target See all PNLIP Antibodies
- PNLIP (Pancreatic Lipase (PNLIP))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PNLIP antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- Lipase antibody (Pancreatic) was raised against the C terminal of PNLIP
- Purification
- Purified
- Immunogen
- Lipase antibody (Pancreatic) was raised using the C terminal of PNLIP corresponding to a region with amino acids GHYADRYPGKTNDVGQKFYLDTGDASNFARWRYKVSVTLSGKKVTGHILV
- Top Product
- Discover our top product PNLIP Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Lipase Blocking Peptide (Pancreatic), catalog no. 33R-3320, is also available for use as a blocking control in assays to test for specificity of this Lipase antibody (Pancreatic)
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PNLIP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PNLIP (Pancreatic Lipase (PNLIP))
- Alternative Name
- Pancreatic Lipase (PNLIP Products)
- Background
- PNLIP is a member of the lipase gene family. PNLIP is a carboxyl esterase that hydrolyzes insoluble, emulsified triglycerides, and is essential for the efficient digestion of dietary fats. It is expressed specifically in the pancreas.
- Molecular Weight
- 51 kDa (MW of target protein)
-