PNLIP antibody (C-Term)

Catalog No. ABIN630164

Product Details anti-PNLIP Antibody

Target: PNLIP (Pancreatic Lipase (PNLIP))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PNLIP antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: Lipase antibody (Pancreatic) was raised against the C terminal of PNLIP

Purification: Purified

Immunogen: Lipase antibody (Pancreatic) was raised using the C terminal of PNLIP corresponding to a region with amino acids GHYADRYPGKTNDVGQKFYLDTGDASNFARWRYKVSVTLSGKKVTGHILV

Application Details

Application Notes: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Lipase Blocking Peptide (Pancreatic), catalog no. 33R-3320, is also available for use as a blocking control in assays to test for specificity of this Lipase antibody (Pancreatic)

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PNLIP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PNLIP

Target: PNLIP (Pancreatic Lipase (PNLIP))

Alternative Name: Pancreatic Lipase (PNLIP Products)

Background: PNLIP is a member of the lipase gene family. PNLIP is a carboxyl esterase that hydrolyzes insoluble, emulsified triglycerides, and is essential for the efficient digestion of dietary fats. It is expressed specifically in the pancreas.

Molecular Weight: 51 kDa (MW of target protein)