Asporin antibody (Middle Region)

Catalog No. ABIN630167

The Rabbit Polyclonal anti-Asporin antibody has been validated for WB and IHC. It is suitable to detect Asporin in samples from Human and Rat.

Quick Overview for Asporin antibody (Middle Region) (ABIN630167)

Target: Asporin (ASPN)

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Asporin antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-Asporin Antibody

Binding Specificity: Middle Region

Specificity: Asporin antibody was raised against the middle region of ASPN

Purification: Purified

Immunogen: Asporin antibody was raised using the middle region of ASPN corresponding to a region with amino acids NKISTVELEDFKRYKELQRLGLGNNKITDIENGSLANIPRVREIHLENNK

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Asporin Blocking Peptide, (ABIN5612193), is also available for use as a blocking control in assays to test for specificity of this Asporin antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASPN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Asporin

Target: Asporin (ASPN)

Alternative Name: Asporin

Background: ASPN belongs to a family of leucine-rich repeat (LRR) proteins associated with the cartilage matrix. The name asporin reflects the unique aspartate-rich N terminus and the overall similarity to decorin.

Molecular Weight: 42 kDa (MW of target protein)