RRM1 antibody (C-Term)

Catalog No. ABIN630171

This anti-RRM1 antibody is a Rabbit Polyclonal antibody detecting RRM1 in WB. Suitable for Human, Mouse, Rat and Dog.

Quick Overview for RRM1 antibody (C-Term) (ABIN630171)

Target: RRM1 (Ribonucleotide Reductase M1 (RRM1))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RRM1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RRM1 Antibody

Binding Specificity: C-Term

Specificity: RRM1 antibody was raised against the C terminal of RRM1

Purification: Purified

Immunogen: RRM1 antibody was raised using the C terminal of RRM1 corresponding to a region with amino acids MHFYGWKQGLKTGMYYLRTRPAANPIQFTLNKEKLKDKEKVSKEEEEKER

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RRM1 Blocking Peptide, (ABIN5615962), is also available for use as a blocking control in assays to test for specificity of this RRM1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RRM1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RRM1

Target: RRM1 (Ribonucleotide Reductase M1 (RRM1))

Alternative Name: RRM1

Background: RRM1 is one of two non-identical subunits that constitute ribonucleoside-diphosphate reductase, an enzyme essential for the production of deoxyribonucleotides prior to DNA synthesis in S phase of dividing cells. Its gene is located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocrotical carcinoma, and lung, ovarian, and breast cancer. Its gene may play a role in malignancies and disease that involve this region.

Molecular Weight: 90 kDa (MW of target protein)

Pathways: Positive Regulation of Endopeptidase Activity