RRM1 antibody (N-Term)

Catalog No. ABIN630191

The Rabbit Polyclonal anti-RRM1 antibody has been validated for WB. It is suitable to detect RRM1 in samples from Human, Mouse, Rat, Zebrafish (Danio rerio), Dog and C. elegans.

Quick Overview for RRM1 antibody (N-Term) (ABIN630191)

Target: RRM1 (Ribonucleotide Reductase M1 (RRM1))

Reactivity: Human, Mouse, Rat, Zebrafish (Danio rerio), Dog, C. elegans

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RRM1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RRM1 Antibody

Binding Specificity: N-Term

Specificity: RRM1 antibody was raised against the N terminal of RRM1

Purification: Purified

Immunogen: RRM1 antibody was raised using the N terminal of RRM1 corresponding to a region with amino acids ATGSYIAGTNGNSNGLVPMLRVYNNTARYVDQGGNKRPGAFAIYLEPWHL

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RRM1 Blocking Peptide, (ABIN936944), is also available for use as a blocking control in assays to test for specificity of this RRM1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RRM1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RRM1

Target: RRM1 (Ribonucleotide Reductase M1 (RRM1))

Alternative Name: RRM1

Background: RRM1 is one of two non-identical subunits that constitute ribonucleoside-diphosphate reductase, an enzyme essential for the production of deoxyribonucleotides prior to DNA synthesis in S phase of dividing cells. Its gene is located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocrotical carcinoma, and lung, ovarian, and breast cancer. Its gene may play a role in malignancies and disease that involve this region.

Molecular Weight: 90 kDa (MW of target protein)

Pathways: Positive Regulation of Endopeptidase Activity