IRF6 antibody (C-Term)

Catalog No. ABIN630193

This Rabbit Polyclonal antibody specifically detects IRF6 in WB. It exhibits reactivity toward Human, Mouse, Rat, Dog and Zebrafish (Danio rerio).

Quick Overview for IRF6 antibody (C-Term) (ABIN630193)

Target: IRF6 (Interferon Regulatory Factor 6 (IRF6))

Reactivity: Human, Mouse, Rat, Dog, Zebrafish (Danio rerio)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IRF6 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-IRF6 Antibody

Binding Specificity: C-Term

Specificity: IRF6 antibody was raised against the C terminal of IRF6

Purification: Purified

Immunogen: IRF6 antibody was raised using the C terminal of IRF6 corresponding to a region with amino acids FLSDLIAHQKGQIEKQPPFEIYLCFGEEWPDGKPLERKLILVQVIPVVAR

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IRF6 Blocking Peptide, (ABIN938372), is also available for use as a blocking control in assays to test for specificity of this IRF6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IRF6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IRF6

Target: IRF6 (Interferon Regulatory Factor 6 (IRF6))

Alternative Name: IRF6

Background: IRF6 is a member of the interferon regulatory transcription factor (IRF) family. Family members share a highly-conserved N-terminal helix-turn-helix DNA-binding domain and a less conserved C-terminal protein-binding domain. Mutations in its gene can cause van der Woude syndrome and popliteal pterygium syndrome. This protein is involved in palate formation.

Molecular Weight: 65 kDa (MW of target protein)