IRF6 antibody (C-Term)

Catalog No. ABIN630193

Product Details anti-IRF6 Antibody

Target: IRF6 (Interferon Regulatory Factor 6 (IRF6))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat, Dog, Zebrafish (Danio rerio)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IRF6 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: IRF6 antibody was raised against the C terminal of IRF6

Purification: Purified

Immunogen: IRF6 antibody was raised using the C terminal of IRF6 corresponding to a region with amino acids FLSDLIAHQKGQIEKQPPFEIYLCFGEEWPDGKPLERKLILVQVIPVVAR

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IRF6 Blocking Peptide, catalog no. 33R-2986, is also available for use as a blocking control in assays to test for specificity of this IRF6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IRF6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IRF6

Target: IRF6 (Interferon Regulatory Factor 6 (IRF6))

Alternative Name: IRF6 (IRF6 Products)

Synonyms: IRF6 antibody, lps antibody, pit antibody, pps antibody, vws antibody, ofc6 antibody, xIRF-6 antibody, DKFZp469E012 antibody, LPS antibody, OFC6 antibody, PIT antibody, PPS antibody, PPS1 antibody, VWS antibody, VWS1 antibody, zgc:63500 antibody, AI876454 antibody, E230028I05Rik antibody, mirf6 antibody, interferon regulatory factor 6 antibody, interferon regulatory factor 6 S homeolog antibody, IRF6 antibody, irf6 antibody, irf6.S antibody, Irf6 antibody

Background: IRF6 is a member of the interferon regulatory transcription factor (IRF) family. Family members share a highly-conserved N-terminal helix-turn-helix DNA-binding domain and a less conserved C-terminal protein-binding domain. Mutations in its gene can cause van der Woude syndrome and popliteal pterygium syndrome. This protein is involved in palate formation.

Molecular Weight: 65 kDa (MW of target protein)