TPTE antibody (C-Term)

Catalog No. ABIN630201

This anti-TPTE antibody is a Rabbit Polyclonal antibody detecting TPTE in WB and IHC. Suitable for Human.

Quick Overview for TPTE antibody (C-Term) (ABIN630201)

Target: TPTE (Transmembrane Phosphatase with Tensin Homology (TPTE))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TPTE antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-TPTE Antibody

Binding Specificity: C-Term

Specificity: TPTE antibody was raised against the C terminal of TPTE

Purification: Purified

Immunogen: TPTE antibody was raised using the C terminal of TPTE corresponding to a region with amino acids KILIDVFDGPPLYDDVKVQFFYSNLPTYYDNCSFYFWLHTSFIENNRLYL

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TPTE Blocking Peptide, (ABIN939824), is also available for use as a blocking control in assays to test for specificity of this TPTE antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TPTE antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TPTE

Target: TPTE (Transmembrane Phosphatase with Tensin Homology (TPTE))

Alternative Name: TPTE

Background: TPTE encodes a putative transmembrane tyrosine phosphatase that may be involved in signal transduction pathways of the endocrine or spermatogenetic function of the testis.

Molecular Weight: 45 kDa (MW of target protein)

Pathways: Inositol Metabolic Process