FICD antibody (C-Term)
Quick Overview for FICD antibody (C-Term) (ABIN630209)
Target
See all FICD AntibodiesReactivity
Host
Clonality
Conjugate
Application
-
-
Binding Specificity
- C-Term
-
Specificity
- FICD antibody was raised against the C terminal Of Ficd
-
Purification
- Purified
-
Immunogen
- FICD antibody was raised using the C terminal Of Ficd corresponding to a region with amino acids FAALAHYKLVYIHPFIDGNGRTSRLLMNLILMQAGYPPITIRKEQRSDYY
-
-
-
-
Application Notes
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. -
Comment
-
FICD Blocking Peptide, (ABIN938222), is also available for use as a blocking control in assays to test for specificity of this FICD antibody
-
Restrictions
- For Research Use only
-
-
-
Format
- Lyophilized
-
Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FICD antibody in PBS
-
Concentration
- Lot specific
-
Buffer
- PBS
-
Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. -
Storage
- 4 °C/-20 °C
-
Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- FICD (FIC Domain Containing (FICD))
-
Alternative Name
- FICD
-
Background
- FICD is an adenylyltransferase that mediates the addition of adenosine 5'-monophosphate (AMP) to specific residues of target proteins. It is able to inactivate Rho GTPases in vitro by adding AMP to RhoA, Rac and Cdc42. It is however unclear whether it inactivates GTPases in vivo and physiological substrates probably remain to be identified.
-
Molecular Weight
- 52 kDa (MW of target protein)
Target
-