DVL1 antibody
-
- Target See all DVL1 Antibodies
- DVL1 (Dishevelled Segment Polarity Protein 1 (DVL1))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DVL1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogen
- DVL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LKITIANAVIGADVVDWLYTHVEGFKERREARKYASSLLKHGFLRHTVNK
- Top Product
- Discover our top product DVL1 Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DVL1 Blocking Peptide, catalog no. 33R-5088, is also available for use as a blocking control in assays to test for specificity of this DVL1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DVL1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DVL1 (Dishevelled Segment Polarity Protein 1 (DVL1))
- Alternative Name
- DVL1 (DVL1 Products)
- Background
- DVL1 is a cytoplasmic phosphoprotein that regulates cell proliferation, acting as a transducer molecule for developmental processes, including segmentation and neuroblast specification. DVL1 gene is a candidate for neuroblastomatous transformation. The Schwartz-Jampel syndrome and Charcot-Marie-Tooth disease type 2A have been mapped to the same region as DVL1 gene. The phenotypes of these diseases may be consistent with defects which might be expected from aberrant expression of a DVL gene during development.
- Molecular Weight
- 38 kDa (MW of target protein)
- Pathways
- WNT Signaling, Synaptic Membrane, Skeletal Muscle Fiber Development
-