IGLL1 antibody (N-Term)

Catalog No. ABIN630214

Product Details anti-IGLL1 Antibody

Target: IGLL1 (Immunoglobulin lambda-Like Polypeptide 1 (IGLL1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IGLL1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: IGLL1 antibody was raised against the N terminal of IGLL1

Purification: Purified

Immunogen: IGLL1 antibody was raised using the N terminal of IGLL1 corresponding to a region with amino acids RSRWGRFLLQRGSWTGPRCWPRGFQSKHNSVTHVFGSGTQLTVLSQPKAT

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IGLL1 Blocking Peptide, catalog no. 33R-8211, is also available for use as a blocking control in assays to test for specificity of this IGLL1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IGLL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IGLL1

Target: IGLL1 (Immunoglobulin lambda-Like Polypeptide 1 (IGLL1))

Alternative Name: IGLL1 (IGLL1 Products)

Synonyms: 14.1 antibody, AGM2 antibody, CD179b antibody, IGL1 antibody, IGL5 antibody, IGLJ14.1 antibody, IGLL antibody, IGO antibody, IGVPB antibody, VPREB2 antibody, IGLV antibody, IGLL1 antibody, MGC151892 antibody, Igll1 antibody, BB139905 antibody, Igl-5 antibody, Igll antibody, Lambda5 antibody, immunoglobulin lambda like polypeptide 1 antibody, immunoglobulin lambda-like polypeptide 1 antibody, IGLL1 antibody, Igll1 antibody

Background: The preB cell receptor is found on the surface of proB and preB cells, where it is involved in transduction of signals for cellular proliferation, differentiation from the proB cell to the preB cell stage, allelic exclusion at the Ig heavy chain gene locus, and promotion of Ig light chain gene rearrangements. The preB cell receptor is composed of a membrane-bound Ig mu heavy chain in association with a heterodimeric surrogate light chain. IGLL1 is one of the surrogate light chain subunits and is a member of the immunoglobulin geneuperfamily. Mutations in its gene can result in B cell deficiency and agammaglobulinemia, an autosomal recessive disease in which few or no gamma globulins or antibodies are made.

Molecular Weight: 19 kDa (MW of target protein)

Pathways: Regulation of Cell Size