NSMCE1 antibody

Catalog No. ABIN630218

The Rabbit Polyclonal anti-NSMCE1 antibody is suitable to detect NSMCE1 in samples from Human, Mouse and Rat. It has been validated for WB.

Quick Overview for NSMCE1 antibody (ABIN630218)

Target: NSMCE1 (Non-SMC Element 1 Homolog (NSMCE1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NSMCE1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-NSMCE1 Antibody

Purification: Purified

Immunogen: NSMCE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RPIYALVNLATTSISKMATDFAENELDLFRKALELIIDSETGFASSTNIL

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NSMCE1 Blocking Peptide, (ABIN5615067), is also available for use as a blocking control in assays to test for specificity of this NSMCE1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NSMCE1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NSMCE1

Target: NSMCE1 (Non-SMC Element 1 Homolog (NSMCE1))

Alternative Name: NSMCE1

Background: NSMCE1 is a probable component of the SMC5-SMC6 complex, a complex involved in DNA double-strand breaks by homologous recombination. The complex may promote sister chromatid homologous recombination by recruiting the SMC1-SMC3 cohesin complex to double-strand breaks.

Molecular Weight: 28 kDa (MW of target protein)

Pathways: Positive Regulation of Response to DNA Damage Stimulus