BDKRB2 antibody (N-Term)

Catalog No. ABIN630235

This Rabbit Polyclonal antibody specifically detects BDKRB2 in WB. It exhibits reactivity toward Human.

Quick Overview for BDKRB2 antibody (N-Term) (ABIN630235)

Target: BDKRB2 (Bradykinin Receptor B2 (BDKRB2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This BDKRB2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-BDKRB2 Antibody

Binding Specificity: N-Term

Specificity: Bradykinin Receptor B2 antibody was raised against the N terminal of BDKRB2

Purification: Purified

Immunogen: Bradykinin Receptor B2 antibody was raised using the N terminal of BDKRB2 corresponding to a region with amino acids MFSPWKISMFLSVREDSVPTTASFSADMLNVTLQGPTLNGTFAQSKCPQV

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Bradykinin Receptor B2 Blocking Peptide, (ABIN5612357), is also available for use as a blocking control in assays to test for specificity of this Bradykinin Receptor B2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BDKRB2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for BDKRB2

Target: BDKRB2 (Bradykinin Receptor B2 (BDKRB2))

Alternative Name: Bradykinin Receptor B2

Background: BDKRB2 is a receptor for bradykinin. The 9 aa bradykinin peptide elicits many responses including vasodilation, edema, smooth muscle spasm and pain fiber stimulation. This receptor associates with G proteins that stimulate a phosphatidylinositol-calcium second messenger system.

Molecular Weight: 43 kDa (MW of target protein)

Pathways: ACE Inhibitor Pathway, Negative Regulation of intrinsic apoptotic Signaling