Annexin V antibody (N-Term)

Catalog No. ABIN630241

This Rabbit Polyclonal antibody specifically detects Annexin V in WB. It exhibits reactivity toward Chemical.

Quick Overview for Annexin V antibody (N-Term) (ABIN630241)

Target: Annexin V (ANXA5) (Annexin A5 (ANXA5))

Reactivity: Chemical

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Annexin V antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Annexin V Antibody

Binding Specificity: N-Term

Specificity: Annexin A5 antibody was raised against the N terminal of ANXA5

Cross-Reactivity: Human, Mouse (Murine), Rat (Rattus), Dog (Canine)

Purification: Purified

Immunogen: Annexin A5 antibody was raised using the N terminal of ANXA5 corresponding to a region with amino acids SELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPE

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Annexin A5 Blocking Peptide, (ABIN5612081), is also available for use as a blocking control in assays to test for specificity of this Annexin A5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANXA5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Annexin V

Target: Annexin V (ANXA5) (Annexin A5 (ANXA5))

Alternative Name: Annexin A5

Target Type: Chemical

Background: The protein encoded by ANXA5 belongs to the annexin family of calcium-dependent phospholipid binding proteins some of which have been implicated in membrane-related events along exocytotic and endocytotic pathways. Annexin 5 is a phospholipase A2 and protein kinase C inhibitory protein with calcium channel activity and a potential role in cellular signal transduction, inflammation, growth and differentiation. Annexin 5 has also been described as placental anticoagulant protein I, vascular anticoagulant-alpha, endonexin II, lipocortin V, placental protein 4 and anchorin CII.

Molecular Weight: 35 kDa (MW of target protein)

Pathways: Apoptosis