Annexin V antibody (N-Term)
-
- Target See all Annexin V (ANXA5) Antibodies
- Annexin V (ANXA5) (Annexin A5 (ANXA5))
-
Binding Specificity
- N-Term
-
Reactivity
- Chemical
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Annexin V antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Annexin A5 antibody was raised against the N terminal of ANXA5
- Cross-Reactivity
- Human, Mouse (Murine), Rat (Rattus), Dog (Canine)
- Purification
- Purified
- Immunogen
- Annexin A5 antibody was raised using the N terminal of ANXA5 corresponding to a region with amino acids SELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPE
- Top Product
- Discover our top product ANXA5 Primary Antibody
-
anti-Annexin A5 (ANXA5) (AA 1-320) antibody
ANXA5 Reactivity: Human WB, ELISA, IP, IHC (p), IF Host: Mouse Monoclonal 1F4-1A5 unconjugated
anti-Annexin A5 (ANXA5) (AA 1-320) antibodyANXA5 Reactivity: Human WB, IHC, IP, ICC Host: Mouse Monoclonal C7 unconjugated
anti-Annexin A5 (ANXA5) (AA 1-321) antibodyANXA5 Reactivity: Cow WB, IHC, IP, ICC Host: Rabbit Polyclonal unconjugated
anti-Annexin A5 (ANXA5) (AA 160-320) antibodyANXA5 Reactivity: Human WB, ELISA, ICC, FACS Host: Mouse Monoclonal 3B9B7 unconjugated
anti-Annexin A5 (ANXA5) (AA 160-320) antibodyANXA5 Reactivity: Human WB, ELISA, FACS Host: Mouse Monoclonal 3B9F3 unconjugated
anti-Annexin A5 (ANXA5) (AA 1-320) antibodyANXA5 Reactivity: Human WB, IP Host: Rabbit Polyclonal unconjugated
anti-Annexin A5 (ANXA5) (AA 88-102), (Middle Region) antibodyANXA5 Reactivity: Human, Rat WB, ICC, IHC (p) Host: Rabbit Polyclonal unconjugated
anti-Annexin A5 (ANXA5) (AA 2-320) antibodyANXA5 Reactivity: Human, Mouse, Rat WB, IHC (p), IHC (fro) Host: Rabbit Polyclonal unconjugated
anti-Annexin A5 (ANXA5) (AA 88-102) antibodyANXA5 Reactivity: Human, Mouse, Rat WB, ICC, IHC (p) Host: Rabbit Polyclonal unconjugated
anti-Annexin A5 (ANXA5) (AA 2-320) antibodyANXA5 Reactivity: Human WB, IHC, ELISA Host: Rabbit Polyclonal unconjugated
-
- Application Notes
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Annexin A5 Blocking Peptide, catalog no. 33R-8393, is also available for use as a blocking control in assays to test for specificity of this Annexin A5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANXA5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Annexin V (ANXA5) (Annexin A5 (ANXA5))
- Alternative Name
- Annexin A5 (ANXA5 Products)
- Target Type
- Chemical
- Background
- The protein encoded by ANXA5 belongs to the annexin family of calcium-dependent phospholipid binding proteins some of which have been implicated in membrane-related events along exocytotic and endocytotic pathways. Annexin 5 is a phospholipase A2 and protein kinase C inhibitory protein with calcium channel activity and a potential role in cellular signal transduction, inflammation, growth and differentiation. Annexin 5 has also been described as placental anticoagulant protein I, vascular anticoagulant-alpha, endonexin II, lipocortin V, placental protein 4 and anchorin CII.
- Molecular Weight
- 35 kDa (MW of target protein)
- Pathways
- Apoptosis
-
