Annexin A13 antibody (N-Term)

Catalog No. ABIN630248

Product Details anti-Annexin A13 Antibody

Target: Annexin A13 (ANXA13)

Binding Specificity: N-Term

Reactivity: Chemical

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Annexin A13 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Annexin A13 antibody was raised against the N terminal of ANXA13

Cross-Reactivity: Human

Purification: Purified

Immunogen: Annexin A13 antibody was raised using the N terminal of ANXA13 corresponding to a region with amino acids EPEAPQPAKASSPQGFDVDRDAKKLNKACKGMGTNEAAIIEILSGRTSDE

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Annexin A13 Blocking Peptide, catalog no. 33R-2628, is also available for use as a blocking control in assays to test for specificity of this Annexin A13 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANXA13 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Annexin A13

Target: Annexin A13 (ANXA13)

Alternative Name: Annexin A13 (ANXA13 Products)

Target Type: Chemical

Background: ANXA13 encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. The specific function of ANXA13 has not yet been determined, however, it is associated with the plasma membrane of undifferentiated, proliferating endothelial cells and differentiated villus enterocytes.

Molecular Weight: 39 kDa (MW of target protein)