Annexin IV antibody (N-Term)

Catalog No. ABIN630249

This anti-Annexin IV antibody is a Rabbit Polyclonal antibody detecting Annexin IV in WB and IHC. Suitable for Chemical.

Quick Overview for Annexin IV antibody (N-Term) (ABIN630249)

Target: Annexin IV (ANXA4) (Annexin A4 (ANXA4))

Reactivity: Chemical

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Annexin IV antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-Annexin IV Antibody

Binding Specificity: N-Term

Specificity: Annexin A4 antibody was raised against the N terminal of ANXA4

Cross-Reactivity: Human, Rat (Rattus), Dog (Canine)

Purification: Purified

Immunogen: Annexin A4 antibody was raised using the N terminal of ANXA4 corresponding to a region with amino acids GLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQ

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Annexin A4 Blocking Peptide, catalog no. 33R-3396, is also available for use as a blocking control in assays to test for specificity of this Annexin A4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANXA4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Annexin IV

Target: Annexin IV (ANXA4) (Annexin A4 (ANXA4))

Alternative Name: Annexin A4

Target Type: Chemical

Background: Annexin A4 (ANXA4) belongs to the annexin family of calcium-dependent phospholipid binding proteins. Although their functions are still not clearly defined, several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. ANXA4 has 45 to 59 % identity with other members of its family and shares a similar size and exon-intron organization. Isolated from human placenta, ANXA4 encodes a protein that has possible interactions with ATP, and has in vitro anticoagulant activity and also inhibits phospholipase A2 activity. ANXA4 is almost exclusively expressed in epithelial cells.

Molecular Weight: 35 kDa (MW of target protein)