Claudin 17 antibody (Middle Region)

Catalog No. ABIN630266

The Rabbit Polyclonal anti-Claudin 17 antibody has been validated for WB and IHC. It is suitable to detect Claudin 17 in samples from Human, Mouse, Rat and Dog.

Quick Overview for Claudin 17 antibody (Middle Region) (ABIN630266)

Target: Claudin 17 (CLDN17)

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Claudin 17 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-Claudin 17 Antibody

Binding Specificity: Middle Region

Specificity: Claudin 17 antibody was raised against the middle region of CLDN17

Purification: Purified

Immunogen: Claudin 17 antibody was raised using the middle region of CLDN17 corresponding to a region with amino acids KQVQCTGSNERAKAYLLGTSGVLFILTGIFVLIPVSWTANIIIRDFYNPA

Application Details

Application Notes: WB: 2 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Claudin 17 Blocking Peptide, (ABIN940002), is also available for use as a blocking control in assays to test for specificity of this Claudin 17 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLDN17 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Claudin 17

Target: Claudin 17 (CLDN17)

Alternative Name: Claudin 17

Background: CLDN17, clustered with CLDN8 at human chromosome 21q22.11, is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C.

Molecular Weight: 25 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization, Hepatitis C