Claudin 9 antibody (C-Term)

Catalog No. ABIN630267

This anti-Claudin 9 antibody is a Rabbit Polyclonal antibody detecting Claudin 9 in WB. Suitable for Human, Mouse, Rat and Dog.

Quick Overview for Claudin 9 antibody (C-Term) (ABIN630267)

Target: Claudin 9 (CLDN9)

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Claudin 9 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Claudin 9 Antibody

Binding Specificity: C-Term

Specificity: Claudin 9 antibody was raised against the C terminal of CLDN9

Purification: Purified

Immunogen: Claudin 9 antibody was raised using the C terminal of CLDN9 corresponding to a region with amino acids WAAAALLMLGGGLLCCTCPPPQVERPRGPRLGYSIPSRSGASGLDKRDYV

Application Details

Application Notes: WB: 2 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Claudin 9 Blocking Peptide, (ABIN5612910), is also available for use as a blocking control in assays to test for specificity of this Claudin 9 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLDN9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Claudin 9

Target: Claudin 9 (CLDN9)

Alternative Name: Claudin 9

Background: CLDN9 is a member of claudin family. It is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C.

Molecular Weight: 24 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization, Hepatitis C