GJC1 antibody (N-Term)

Catalog No. ABIN630269

The Rabbit Polyclonal anti-GJC1 antibody has been validated for WB. It is suitable to detect GJC1 in samples from Human and Rat.

Quick Overview for GJC1 antibody (N-Term) (ABIN630269)

Target: GJC1 (Gap Junction Protein, gamma 1, 45kDa (GJC1))

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GJC1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-GJC1 Antibody

Binding Specificity: N-Term

Specificity: GJC1 antibody was raised against the N terminal of GJC1

Purification: Purified

Immunogen: GJC1 antibody was raised using the N terminal of GJC1 corresponding to a region with amino acids IFRILVLATVGGAVFEDEQEEFVCNTLQPGCRQTCYDRAFPVSHYRFWLF

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GJC1 Blocking Peptide, (ABIN939347), is also available for use as a blocking control in assays to test for specificity of this GJC1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GJC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GJC1

Target: GJC1 (Gap Junction Protein, gamma 1, 45kDa (GJC1))

Alternative Name: GJC1

Background: CX31.9 is a member of the large family of connexins that are required for the formation of gap junctions. Six connexin monomers form a hemichannel, or connexon, on the cell surface. This connexon can interact with a connexon from a neighboring cell, thus forming a channel linking the cytoplasm of the 2 cells.

Molecular Weight: 32 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization