ITGBL1 antibody

Catalog No. ABIN630272

The Rabbit Polyclonal anti-ITGBL1 antibody has been validated for WB. It is suitable to detect ITGBL1 in samples from Human and Dog.

Quick Overview for ITGBL1 antibody (ABIN630272)

Target: ITGBL1 (Integrin, beta-Like 1 (With EGF-Like Repeat Domains) (ITGBL1))

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ITGBL1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ITGBL1 Antibody

Purification: Purified

Immunogen: ITGBL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MRPPGFRNFLLLASSLLFAGLSAVPQSFSPSLRSWPGAACRLSRAESERR

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ITGBL1 Blocking Peptide, (ABIN5614228), is also available for use as a blocking control in assays to test for specificity of this ITGBL1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ITGBL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ITGBL1

Target: ITGBL1 (Integrin, beta-Like 1 (With EGF-Like Repeat Domains) (ITGBL1))

Alternative Name: ITGBL1

Background: The function of ITGBL1 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 54 kDa (MW of target protein)