P-Cadherin antibody

Catalog No. ABIN630281

Product Details anti-P-Cadherin Antibody

Target: P-Cadherin (CDH3)

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This P-Cadherin antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogen: CDH3 antibody was raised using a synthetic peptide corresponding to a region with amino acids AVSENGASVEDPMNISIIVTDQNDHKPKFTQDTFRGSVLEGVLPGTSVMQ

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CDH3 Blocking Peptide, catalog no. 33R-1615, is also available for use as a blocking control in assays to test for specificity of this CDH3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDH3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for P-Cadherin

Target: P-Cadherin (CDH3)

Alternative Name: CDH3 (CDH3 Products)

Background: CDH3 is a classical cadherin from the cadherin superfamily. The protein is a calcium-dependent cell-cell adhesion glycoprotein comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. Its gene is located in a six-cadherin cluster in a region on the long arm of chromosome 16 that is involved in loss of heterozygosity events in breast and prostate cancer. In addition, aberrant expression of this protein is observed in cervical adenocarcinomas. Mutations in its gene have been associated with congential hypotrichosis with juvenile macular dystrophy.

Molecular Weight: 91 kDa (MW of target protein)