Glucagon antibody (N-Term)

Catalog No. ABIN630283

This Rabbit Polyclonal antibody specifically detects Glucagon in WB. It exhibits reactivity toward Human, Rat, Mouse and Dog.

Quick Overview for Glucagon antibody (N-Term) (ABIN630283)

Target: Glucagon (GCG)

Reactivity: Human, Rat, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Glucagon antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Glucagon Antibody

Binding Specificity: N-Term

Specificity: Glucagon antibody was raised against the N terminal of GCG

Purification: Purified

Immunogen: Glucagon antibody was raised using the N terminal of GCG corresponding to a region with amino acids LSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAK

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Glucagon Blocking Peptide, (ABIN5613789), is also available for use as a blocking control in assays to test for specificity of this Glucagon antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Glucagon antibody is supplied as lyophilized powder. Add distilled water for a 1 mg/mL concentration of GCG antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Glucagon

Target: Glucagon (GCG)

Alternative Name: Glucagon

Background: GCG is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signalling pathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an active enteroglucagon.

Molecular Weight: 20 kDa (MW of target protein)

Pathways: Positive Regulation of Peptide Hormone Secretion, Peptide Hormone Metabolism, cAMP Metabolic Process, Regulation of Carbohydrate Metabolic Process, Feeding Behaviour, Negative Regulation of intrinsic apoptotic Signaling