ADIPOQ antibody (N-Term)

Catalog No. ABIN630285

Product Details anti-ADIPOQ Antibody

Target: ADIPOQ (Adiponectin (ADIPOQ))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ADIPOQ antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: ACDC antibody was raised against the N terminal Of Acdc

Purification: Purified

Immunogen: ACDC antibody was raised using the N terminal Of Acdc corresponding to a region with amino acids KGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIP

Application Details

Application Notes: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ACDC Blocking Peptide, catalog no. 33R-4384, is also available for use as a blocking control in assays to test for specificity of this ACDC antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACDC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ADIPOQ

Target: ADIPOQ (Adiponectin (ADIPOQ))

Alternative Name: ACDC (ADIPOQ Products)

Synonyms: ADP antibody, DCAF9 antibody, 6720489L24Rik antibody, 9330209L04Rik antibody, Adp antibody, Mamdc1 antibody, RNSVSP4U antibody, SVSIV1 antibody, Svp4 antibody, ACDC antibody, ACRP30 antibody, ADIPQTL1 antibody, ADPN antibody, APM-1 antibody, APM1 antibody, GBP28 antibody, apM-1 antibody, 30kDa antibody, APN antibody, Acdc antibody, Acrp30 antibody, Ad antibody, adipo antibody, apM1 antibody, ADN antibody, acrpl antibody, adipo-b antibody, adipoql antibody, zgc:153584 antibody, adipoq antibody, WD and tetratricopeptide repeats 1 antibody, MAM domain containing glycosylphosphatidylinositol anchor 2 antibody, seminal vesicle secretory protein 4 antibody, adiponectin, C1Q and collagen domain containing antibody, adiponectin, C1Q and collagen domain containing, b antibody, adiponectin, C1Q and collagen domain containing L homeolog antibody, WDTC1 antibody, Mdga2 antibody, Svs4 antibody, ADIPOQ antibody, Adipoq antibody, adipoqb antibody, adipoq.L antibody

Background: Adiponectin (ACDC) is expressed in adipose tissue exclusively. It is similar to collagens X and VIII and complement factor C1q. Adiponectin circulates in the plasma and is involved with metabolic and hormonal processes.

Molecular Weight: 27 kDa (MW of target protein)