ADIPOQ antibody (N-Term)

Catalog No. ABIN630285

The Rabbit Polyclonal anti-ADIPOQ antibody (ABIN630285) specifically detects ADIPOQ in WB and IHC. The antibody is reactive with Human samples.

Quick Overview for ADIPOQ antibody (N-Term) (ABIN630285)

Target: ADIPOQ (Adiponectin (ADIPOQ))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ADIPOQ antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-ADIPOQ Antibody

Binding Specificity: N-Term

Specificity: ACDC antibody was raised against the N terminal Of Acdc

Purification: Purified

Immunogen: ACDC antibody was raised using the N terminal Of Acdc corresponding to a region with amino acids KGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIP

Application Details

Application Notes: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ACDC Blocking Peptide, (ABIN939770), is also available for use as a blocking control in assays to test for specificity of this ACDC antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACDC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ADIPOQ

Target: ADIPOQ (Adiponectin (ADIPOQ))

Alternative Name: ACDC

Background: Adiponectin (ACDC) is expressed in adipose tissue exclusively. It is similar to collagens X and VIII and complement factor C1q. Adiponectin circulates in the plasma and is involved with metabolic and hormonal processes.

Molecular Weight: 27 kDa (MW of target protein)