DKK1 antibody

Catalog No. ABIN630289

Product Details anti-DKK1 Antibody

Target: DKK1 (Dickkopf Homolog 1 (DKK1))

Reactivity: Human, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DKK1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: DKK1 antibody was raised using a synthetic peptide corresponding to a region with amino acids CARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKD

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DKK1 Blocking Peptide, catalog no. 33R-1645, is also available for use as a blocking control in assays to test for specificity of this DKK1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DKK1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DKK1

Target: DKK1 (Dickkopf Homolog 1 (DKK1))

Alternative Name: DKK1 (DKK1 Products)

Background: DKK1 is a protein that is a member of the dickkopf family. It is a secreted protein with two cysteine rich regions and is involved in embryonic development through its inhibition of the WNT signaling pathway. Elevated levels of DKK1 in bone marrow plasma and peripheral blood is associated with the presence of osteolytic bone lesions in patients with multiple myeloma.

Molecular Weight: 26 kDa (MW of target protein)

Pathways: WNT Signaling, Regulation of Muscle Cell Differentiation, Positive Regulation of fat Cell Differentiation